Basic Information | |
---|---|
Taxon OID | 3300014053 Open in IMG/M |
Scaffold ID | Ga0119956_1016126 Open in IMG/M |
Source Dataset Name | Contaminated water microbial communities from Hexachlorocyclohexane (HCH) contaminated sediment in Lucknow, India - Pond Sediment |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Delhi |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 553 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Pond → Sediment → Contaminated Water → Contaminated Water Microbial Communities From Pond Sediment In Lucknow, India |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | India: Chinhat, Lucknow | |||||||
Coordinates | Lat. (o) | 26.5389 | Long. (o) | 81.2022 | Alt. (m) | Depth (m) | .1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051390 | Metagenome | 144 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0119956_10161261 | F051390 | N/A | DWYGDTFGLVVGDQVPGDDQLTLTVAKSNQLVILRKVDKVADRSTQCYRGPHVDLRSDEASYPEMLKRFNRKETYWGPDPNLIPWHEPDTNTAYGYDPFGNQLFLRVRERIC* |
⦗Top⦘ |