NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0119952_1063128

Scaffold Ga0119952_1063128


Overview

Basic Information
Taxon OID3300014050 Open in IMG/M
Scaffold IDGa0119952_1063128 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGeorgia Institute of Technology
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)957
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier In Georgia, Usa

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)34.21Long. (o)-83.96Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F079964Metagenome / Metatranscriptome115N

Sequences

Protein IDFamilyRBSSequence
Ga0119952_10631281F079964GGAGMPEVVVVDPELSVYGPVEEITVSVDIGQTGTRGSKQFVGAGLPGALTVPETPLSNDMYLDISNGDMYQYIDSVWEQVGNIAPIFYNVNETVTFISGNANFTYDIEDMFGITSTTKAFIIQHNIIGTTNVIASVITEPILTGTELDFSIKAKSLSGTTWSNLSGDYDVMISISLGEDNTSSAS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.