Scaffold Ga0117792_1013058

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0117792_1013058

Scaffold Ga0117792_1013058

Overview

Basic Information
Taxon OID	3300013941 Open in IMG/M
Scaffold ID	Ga0117792_1013058 Open in IMG/M
Source Dataset Name	Epidermal mucus viral and microbial communities from European eel in Spain - water from Alfacada pond (Ebro delta)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Valencia
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	993
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Fish → Skin → Epidermal Mucus → Unclassified → Epidermal Mucus → Epidermal Mucus Viral And Microbial Communities From European Eel In Spain

Source Dataset Sampling Location
Location Name	Spain: Alfacada pond
Coordinates	Lat. (^o)	40.647955	Long. (^o)	-0.738702	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080002	Metagenome	115	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0117792_10130581	F080002	N/A	MAVTTYTSPAYSQSSTNELKRPCLWDDEHKIENLPAWIYSDNQPPNSTEECEAKLSSLNYTIRDIELQIEIRELELKTGSSRHGNAFDFERWKVGALKAKQTHLYLLNAYTYWLLKNTPRVLDTASKLDKLIALLVEDPADFEQKASALLN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.