Scaffold Ga0117807_1000962

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0117807_1000962

Scaffold Ga0117807_1000962

Overview

Basic Information
Taxon OID	3300013940 Open in IMG/M
Scaffold ID	Ga0117807_1000962 Open in IMG/M
Source Dataset Name	Human gut microbial communities from patients with symptomatic atherosclerosis - Chalmers University of Technology - 252
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Chalmers University of Technology
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	10740
Total Scaffold Genes	15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	10 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Unclassified → Unclassified → Human Gut → Human Gut Microbial Communities From Patients With Symptomatic Atherosclerosis - Chalmers University Of Technology

Source Dataset Sampling Location
Location Name
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039198	Metagenome	164	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0117807_10009621	F039198	AGG	MKLTIAEIQSTKYVQIYLTEDELQKKETKDLAQKYKQEKYSVAIFVSGKENYPEILEKII

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.