Basic Information | |
---|---|
Taxon OID | 3300013873 Open in IMG/M |
Scaffold ID | Ga0181464_1005686 Open in IMG/M |
Source Dataset Name | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In2-11 gowning area SPAdes reassembly |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 5059 |
Total Scaffold Genes | 9 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Clean Room → Clean Room Microbial Communities From Nasa Spacecraft Assembly Facility At Jet Propulsion Laboratory, Pasadena, California, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Jet Propulsion Laboratory, Pasadena, California | |||||||
Coordinates | Lat. (o) | 34.1 | Long. (o) | -118.1 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F046363 | Metagenome / Metatranscriptome | 151 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0181464_10056862 | F046363 | N/A | MIFGRDGFRSMVLDASACINMYCNIERNIMKNQAGSPGFGIQGKISVHMCFMCYALALFIFFV* |
⦗Top⦘ |