Scaffold Ga0181471_100339

Overview

Basic Information

• Taxon OID: 3300013865
• Scaffold ID: Ga0181471_100339
• Source Dataset Name: Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In5p-11 gowning area SPAdes reassembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 15476
• Total Scaffold Genes: 19
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 11 (57.89%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Clean Room → Clean Room Microbial Communities From Nasa Spacecraft Assembly Facility At Jet Propulsion Laboratory, Pasadena, California, Usa

Source Dataset Sampling Location

• Location Name: USA: Jet Propulsion Laboratory, Pasadena, California
• Coordinates
  • Lat. (^o): 34.1
  • Long. (^o): -118.1
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078089	Metagenome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0181471_1003398	F078089	N/A	LHEGKIIEQAYVILLKLDKNKEVLVGNDWGKIGKLEELHW*