NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0120132_1023794

Scaffold Ga0120132_1023794


Overview

Basic Information
Taxon OID3300013832 Open in IMG/M
Scaffold IDGa0120132_1023794 Open in IMG/M
Source Dataset NamePermafrost microbial communities from Nunavut, Canada - A3_5cm_0M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Tennessee
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1095
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost Microbial Communities From Nunavut, Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameCanada: Axel Heiberg Island, Nunavut
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m).05
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F054442Metagenome / Metatranscriptome140N

Sequences

Protein IDFamilyRBSSequence
Ga0120132_10237942F054442AGGMHGIKGDDAVRDMEFAEQLLRGGDFVGLFRDIDVCQDETGFDVEGVQHLGRLAVGEIVEASSECLAIDRDDTSRRIGNGAAQTGGVLAENLLDRLGFKALEDVSNRGMGWGTPPVQTEGGVQSAAMHFDEGHDGTIGIAAGDDSKDREQQDML*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.