Scaffold Ga0120158_10535568

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0120158_10535568

Scaffold Ga0120158_10535568

Overview

Basic Information
Taxon OID	3300013772 Open in IMG/M
Scaffold ID	Ga0120158_10535568 Open in IMG/M
Source Dataset Name	Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Tennessee
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	507
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost Microbial Communities From Nunavut, Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location Name	Canada: Axel Heiberg Island, Nunavut
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)	.8
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020969	Metagenome / Metatranscriptome	221	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0120158_105355681	F020969	GGAGG	MSLSKLFLIVALICFILEALGSRMKFRSPFGLLGAG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.