Scaffold Ga0119887_1087134

Overview

Basic Information

• Taxon OID: 3300013769
• Scaffold ID: Ga0119887_1087134
• Source Dataset Name: Sewage treatment plant microbial communities from Vermont, USA - Sand_B
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Norwich University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 885
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Sewage Treatment Plant → Sewage Treatment Plant Microbial Communities From Vermont, Usa

Source Dataset Sampling Location

• Location Name: USA: Vermont
• Coordinates
  • Lat. (^o): 43.727094
  • Long. (^o): -72.425964

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009854	Metagenome / Metatranscriptome	312	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0119887_10871342	F009854	GAGG	MNTIGMQDEVFEAMRSLAELVPEMRSGQLLAAVGELCSDLHGRGLWDASDEELLEAVWQFRRDLEAVMIVPNRRDDHDDP*