 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300013769 Open in IMG/M |
| Scaffold ID | Ga0119887_1006521 Open in IMG/M |
| Source Dataset Name | Sewage treatment plant microbial communities from Vermont, USA - Sand_B |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Norwich University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3787 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Sewage Treatment Plant → Sewage Treatment Plant Microbial Communities From Vermont, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Vermont | |||||||
| Coordinates | Lat. (o) | 43.727094 | Long. (o) | -72.425964 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F061020 | Metagenome | 132 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0119887_10065213 | F061020 | GGAGG | MRRIPFLACVAIMATATSTGIASAGPVRDLYSNGAFGLPWNAGKADIQSRFPGGNWAEDDKGRPKYCAPSRQTLLKLPAQFQSKEMCFLIGTDGTLASATATLEPSLQSLLAIVNRCRTTFGDFDAVVRDQQAIQSRSTAMLWTRDAPYVVRIESQNDTDGRPLVVTYTVADEANLYTAGASKVSTVPDPVKK* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |