Scaffold Ga0120195_1003414

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0120195_1003414

Scaffold Ga0120195_1003414

Overview

Basic Information
Taxon OID	3300013500 Open in IMG/M
Scaffold ID	Ga0120195_1003414 Open in IMG/M
Source Dataset Name	Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T4.rep2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Georgia Institute of Technology
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	865
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial → Terrestrial Microbial Communites From A Soil Warming Plot In Okalahoma, Usa

Source Dataset Sampling Location
Location Name	USA: Kessler Farm Field Laboratory (KFFL), Okalahoma
Coordinates	Lat. (^o)	34.975667	Long. (^o)	-97.519	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025140	Metagenome	203	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0120195_10034141	F025140	GAG	MASTREKLIDWLADLPDNTEIGIEDIYLVAMIGKRTQDFLVGDLSNESIDIDLATFCGQRRDMMERMVEIHKAGAGIGTTEGVMVVTFEGYIRGVPEFFTNDATEAFRFKDRKQAEDFITEFADALHNPQVLDYP*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.