Scaffold Ga0180015_1063741

Overview

Basic Information

• Taxon OID: 3300013392
• Scaffold ID: Ga0180015_1063741
• Source Dataset Name: Groundwater microbial communities from the Olkiluoto Island deep subsurface site, Finland - KR13_S2_MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 580
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Three Deep Subsurface Sites In Europe

Source Dataset Sampling Location

• Location Name: Finland: the Olkiluoto Island
• Coordinates
  • Lat. (^o): 61.2418
  • Long. (^o): 21.4803
  • Depth (m): 410

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093357	Metagenome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0180015_10637412	F093357	N/A	MERIIQKKMKNFEQAWQIKRFLAERGESISSLSRKLNRPFGSVANNIYGYRANAQLQREIADFLGKPVAKLFGGAGPVRG*