Basic Information | |
---|---|
Taxon OID | 3300013392 Open in IMG/M |
Scaffold ID | Ga0180015_1007332 Open in IMG/M |
Source Dataset Name | Groundwater microbial communities from the Olkiluoto Island deep subsurface site, Finland - KR13_S2_MetaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2213 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Three Deep Subsurface Sites In Europe |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Finland: the Olkiluoto Island | |||||||
Coordinates | Lat. (o) | 61.2418 | Long. (o) | 21.4803 | Alt. (m) | Depth (m) | 410 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F065254 | Metagenome | 128 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0180015_10073323 | F065254 | N/A | VALNKGSEQAEKASVATETLLWGCPITNFKATLPFNRMNQSRRGGIAAFKKRPHGPALARFKGYN* |
⦗Top⦘ |