Scaffold Ga0180014_1021691

Overview

Basic Information

• Taxon OID: 3300013391
• Scaffold ID: Ga0180014_1021691
• Source Dataset Name: Groundwater microbial communities from the Olkiluoto Island deep subsurface site, Finland - KR13_S1_MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 740
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Three Deep Subsurface Sites In Europe

Source Dataset Sampling Location

• Location Name: Finland: the Olkiluoto Island
• Coordinates
  • Lat. (^o): 61.2418
  • Long. (^o): 21.4803
  • Depth (m): 410

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034814	Metagenome	173	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0180014_10216911	F034814	AGGAGG	MTSLAAEKIETLPGLHSCFTCADNMGCNLEMRCESMAGCLKWRCRVCRAPWWAVGYHHESCNATGVPNGVTYHDGTHMAPLPEASGHYYRHGGYCRVHQSWRCGLGRPDADQ*