Scaffold Ga0177922_11207213

Overview

Basic Information

• Taxon OID: 3300013372
• Scaffold ID: Ga0177922_11207213
• Source Dataset Name: Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Molecular Research LP (MR DNA)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 17033
• Total Scaffold Genes: 28
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 23 (82.14%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Central Basin Lake Erie, Ontario, Canada

Source Dataset Sampling Location

• Location Name: Ontario, Canada
• Coordinates
  • Lat. (^o): 42.844722
  • Long. (^o): -79.573889
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088805	Metagenome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0177922_1120721323	F088805	GGA	MSLSPHQAFMLKHFAMGWKFKLVNDKPGSWVTYWSLRRRGLVDAGSVITEQGREVPAKEMRLQAKREARK*