Scaffold Ga0173609_10718734

Overview

Basic Information

• Taxon OID: 3300013315
• Scaffold ID: Ga0173609_10718734
• Source Dataset Name: Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA - 1B
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of California, Davis
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4996
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment → Sediment Microbial Communities From Acid Mine Drainage (Amd) Holding Pond In Pittsburgh, Pa, Usa

Source Dataset Sampling Location

• Location Name: Pittsburgh PA
• Coordinates
  • Lat. (^o): 40.4406
  • Long. (^o): -79.9959

Associated Families

Family	Category	Number of Sequences	3D Structure?
F096266	Metagenome	105	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0173609_107187344	F096266	GGA	MFDARFIFLLLTGFLLAVLVAISVTTLKKNRKRKLEEPKHRMLKDD*