Basic Information | |
---|---|
Taxon OID | 3300013315 Open in IMG/M |
Scaffold ID | Ga0173609_10701430 Open in IMG/M |
Source Dataset Name | Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA - 1B |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of California, Davis |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1287 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment → Sediment Microbial Communities From Acid Mine Drainage (Amd) Holding Pond In Pittsburgh, Pa, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Pittsburgh PA | |||||||
Coordinates | Lat. (o) | 40.4406 | Long. (o) | -79.9959 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F031548 | Metagenome / Metatranscriptome | 182 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0173609_107014301 | F031548 | AGGAGG | VKTNIMKIFAIATFMVFIGAGVSMADGWNENGGNRGHAYGHYKQREYPHYQSYAPRPVYIERHYRPVVVERHVYRQPVVYQAPAPRWFFFGMTVVEPGMAFSFGVGGH* |
⦗Top⦘ |