Scaffold Ga0173609_10506697

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0173609_10506697

Scaffold Ga0173609_10506697

Overview

Basic Information
Taxon OID	3300013315 Open in IMG/M
Scaffold ID	Ga0173609_10506697 Open in IMG/M
Source Dataset Name	Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA - 1B
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of California, Davis
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2654
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment → Sediment Microbial Communities From Acid Mine Drainage (Amd) Holding Pond In Pittsburgh, Pa, Usa

Source Dataset Sampling Location
Location Name	Pittsburgh PA
Coordinates	Lat. (^o)	40.4406	Long. (^o)	-79.9959	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072480	Metagenome / Metatranscriptome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0173609_105066973	F072480	AGGA	MGTPDYVKILKLDKIAMKSKNRLDFLNAVKPRLQYAKNIGVEGSFPFFVERAWGIFGDGL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.