Scaffold Ga0173609_10265883

Overview

Basic Information

• Taxon OID: 3300013315
• Scaffold ID: Ga0173609_10265883
• Source Dataset Name: Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA - 1B
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of California, Davis
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1428
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment → Sediment Microbial Communities From Acid Mine Drainage (Amd) Holding Pond In Pittsburgh, Pa, Usa

Source Dataset Sampling Location

• Location Name: Pittsburgh PA
• Coordinates
  • Lat. (^o): 40.4406
  • Long. (^o): -79.9959

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056991	Metagenome / Metatranscriptome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0173609_102658833	F056991	GGAGG	MKTRLVIGMAIVCLTAGMWALPARGDESPVDQQKNYYLKCINAEIDSYSCKVGYATSRSKNLQAYGDSAARRTAFLTKNRDALSQEMLAQKVNMRPHAVHQYLGQRFSQEAPVQMTMERP