Scaffold Ga0175859_1084064

Overview

Basic Information

• Taxon OID: 3300013314
• Scaffold ID: Ga0175859_1084064
• Source Dataset Name: Moss microbial communities from three moss species from boreal forest in Fairbanks, Alaska, USA Reanalysis
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Colorado
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1368
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Moss Associated → Moss Microbial Communities From Three Moss Species From Boreal Forest In Fairbanks, Ak, Usa

Source Dataset Sampling Location

• Location Name: USA: Fairbanks, AK
• Coordinates
  • Lat. (^o): 64.8591667
  • Long. (^o): -147.8247222

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033406	Metagenome	177	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0175859_10840642	F033406	AGGAG	MEPLHEALRLIKRQTELELAMRRPGGIRVTEERELFQLRHALTQYPAAVTAIVEAAARMRRPVDTISIDDIEATGEPATSH*