Scaffold Ga0173629_10029151

Overview

Basic Information

• Taxon OID: 3300013313
• Scaffold ID: Ga0173629_10029151
• Source Dataset Name: Marine surface microbial communities from Baltic Sea. Combined Assembly of 24 SPs re-assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Berlin Center for Genomics in Biodiversity Research (BeGenDiv)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 717
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Pelagic → Unclassified → Marine → Marine Surface Microbial Communities From Baltic Sea - Bioacid_Cyano

Source Dataset Sampling Location

• Location Name: Baltic Sea
• Coordinates
  • Lat. (^o): 57.32
  • Long. (^o): 20.05

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010769	Metagenome / Metatranscriptome	299	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0173629_100291511	F010769	N/A	QELQAVCSGAMFQTCLDFLESSEVSTPQCDAVFLGPDIGFANVLLYNDADGTCEISLTELAAVCRQFFEECMAFLESSEPQRQCDPIFLGPDLGYVNLMVFNDADGSCELSMQELAAVCSGAMLQTCLDFLESSEPGSQPECEPVFLGPDLGLVNIMRYNDVDGSCELSMQELAAVCSGAMFQTCIDFLASSEPPPQCDPVYLGPELGYQNLLVFHDADGSCELSIQELARVCTGAMF