Scaffold Ga0157378_10246511

Overview

Basic Information

• Taxon OID: 3300013297
• Scaffold ID: Ga0157378_10246511
• Source Dataset Name: Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1709
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location

• Location Name: USA: Michigan
• Coordinates
  • Lat. (^o): 42.3948
  • Long. (^o): -85.3738

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017060	Metagenome / Metatranscriptome	243	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0157378_102465113	F017060	AGG	MSRSAESPVQLASGGRDDLRQLFAMSFAEPSRDDDDLRHAVLDYVRNAKAERRTPEMVIVSLKRAIIDAAAARISYRAANELTDRVVRWFIDGYYGVDASPVDRGLDLRMGPAPRPS*