Scaffold Ga0170791_12540154

Overview

Basic Information

• Taxon OID: 3300013295
• Scaffold ID: Ga0170791_12540154
• Source Dataset Name: northern Canada Lakes metatranscriptome co-assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 666
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location

• Location Name: Canada: Quebec
• Coordinates
  • Lat. (^o): 46.8319
  • Long. (^o): -72.5
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046240	Metagenome	151	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0170791_125401542	F046240	N/A	MNVRIQCDLDLLAGVYYEDQLQMNRYTVSLNLLTKSKDSASTNVALDRAKAFVHGALESTVFINQANMPRAEMMQLMGINVTTLPEEPVDQVIGMMLYYK