Basic Information | |
---|---|
Taxon OID | 3300013293 Open in IMG/M |
Scaffold ID | Ga0120688_1028642 Open in IMG/M |
Source Dataset Name | Aquatic prokaryotic and eukaryotic communities from a canal in New York, USA: aquatic canal water -GCSS-13 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Weill Cornell Medical College |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 525 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Built Environment → Canal → Unclassified → Unclassified → Aquatic Canal → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA:New York City | |||||||
Coordinates | Lat. (o) | 40.67 | Long. (o) | -73.99 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F072362 | Metagenome / Metatranscriptome | 121 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0120688_10286421 | F072362 | AGGAG | MHKLFAIGVLIYLVGDPGLSMLASFSEARELIVASALALIAVPWVVSQIDN* |
⦗Top⦘ |