Basic Information | |
---|---|
Taxon OID | 3300013233 Open in IMG/M |
Scaffold ID | Ga0172420_10909117 Open in IMG/M |
Source Dataset Name | Combined Assembly of Gp0198154, Gp0198156, Gp0198157, Gp0198161 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Western Washington University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 658 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine → Marine Microbial Mat From Mariana Arc And Backarc, Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Pacific Ocean | |||||||
Coordinates | Lat. (o) | 12.916667 | Long. (o) | 143.633333 | Alt. (m) | Depth (m) | 2931 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F071654 | Metagenome | 122 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0172420_109091172 | F071654 | N/A | MPERSELTDTVKLTAGELITMRKNTKPGIPLMQESVTRRDASNRIHAMSPEQRQQFIDKNGIDEVMRIIGDDLPPPAPGANAGSLPLNIG* |
⦗Top⦘ |