Scaffold Ga0170573_11078591

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0170573_11078591

Scaffold Ga0170573_11078591

Overview

Basic Information
Taxon OID	3300013232 Open in IMG/M
Scaffold ID	Ga0170573_11078591 Open in IMG/M
Source Dataset Name	Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA ? S1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of California, Davis
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	747
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment → Sediment Microbial Communities From Acid Mine Drainage (Amd) Holding Pond In Pittsburgh, Pa, Usa

Source Dataset Sampling Location
Location Name	Pittsburgh
Coordinates	Lat. (^o)	40.44	Long. (^o)	-79.99	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061329	Metagenome	132	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0170573_110785912	F061329	N/A	ERALKLMVIVLSSINALMWLLYTESPVMASVWGGTAIGFAFWIADDMRR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.