Scaffold Ga0118560_120557

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0118560_120557

Scaffold Ga0118560_120557

Overview

Basic Information
Taxon OID	3300013215 Open in IMG/M
Scaffold ID	Ga0118560_120557 Open in IMG/M
Source Dataset Name	Human skin bacterial and viral communities - University of Pennsylvania - MG100470
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Pennsylvania
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	501
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Skin → Unclassified → Unclassified → Human Skin → Human Skin Bacterial And Viral Communities - University Of Pennsylvania

Source Dataset Sampling Location
Location Name
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)	3.9624
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067490	Metagenome / Metatranscriptome	125	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0118560_1205571	F067490	N/A	GRLFINEAQTGVMAWWSMGRWTDRAAREAIIAQAKTMTLADFRRWFARHEASFLVD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.