NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0118560_110836

Scaffold Ga0118560_110836


Overview

Basic Information
Taxon OID3300013215 Open in IMG/M
Scaffold IDGa0118560_110836 Open in IMG/M
Source Dataset NameHuman skin bacterial and viral communities - University of Pennsylvania - MG100470
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Pennsylvania
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)706
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Skin → Unclassified → Unclassified → Human Skin → Human Skin Bacterial And Viral Communities - University Of Pennsylvania

Source Dataset Sampling Location
Location Name
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)3.9624
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009273Metagenome / Metatranscriptome320Y

Sequences

Protein IDFamilyRBSSequence
Ga0118560_1108361F009273GGAMYLLDPQQGEARRDLVRGSVSDYGRQTGAFAHETGGTRGRQEQGVLATARRPFRRQPGLGERLLAHAEQLGTTTGMVLVGCVGLGVGLGYLWAHQGSPEPRVQLREKARTYWRPTETRQAHQRALSRHWRFFQGRDTPRV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.