Scaffold Ga0172421_121196

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0172421_121196

Scaffold Ga0172421_121196

Overview

Basic Information
Taxon OID	3300013212 Open in IMG/M
Scaffold ID	Ga0172421_121196 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Saiful Muluk Lake, Pakistan
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	BGI Tech Solutions Co., Ltd.
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	15108
Total Scaffold Genes	24 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	12 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Saiful Muluk Lake, Pakistan

Source Dataset Sampling Location
Location Name	Saiful Muluk Lake, Naran, Pakistan
Coordinates	Lat. (^o)	34.8762	Long. (^o)	73.6934	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005589	Metagenome	395	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0172421_12119614	F005589	AGGA	MTKYKHYFWRYVPSTEKHKSEFKFVETFETDSDDVPEFHDHYCIDHIVNLETGQMRVKNHSAPEYCVSKYIGWSLELPPVEKANKQDIYIVVHKSSFSHKRIEFDEFLEPEINRYNQREWNFLLSVIESRFNKQKEWAKDGIKIPSQYDDGTQVFKTENEFRAFSLGRRAYFLYHLVRNYKFKHLIRRLNIGYTQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.