Basic Information | |
---|---|
Taxon OID | 3300013212 Open in IMG/M |
Scaffold ID | Ga0172421_118574 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Saiful Muluk Lake, Pakistan |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | BGI Tech Solutions Co., Ltd. |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 11121 |
Total Scaffold Genes | 13 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 11 (84.62%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Saiful Muluk Lake, Pakistan |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Saiful Muluk Lake, Naran, Pakistan | |||||||
Coordinates | Lat. (o) | 34.8762 | Long. (o) | 73.6934 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002722 | Metagenome | 534 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0172421_1185748 | F002722 | AGG | MAGRTGVRATVYSFLSSPQITNLNQIFISFPKRIDFNVNTTAGSDTRAAAIIFIAAETESRIAIGGATNGIKRVDYTIILQIYQHSFERNAEAAMTNFDTLIDAIKTRLRSDHRFGDANGNLVWQGAEPSITTRYGEPSTEKEGMTETYAEVEFDVTEMIYA* |
⦗Top⦘ |