Scaffold Ga0172362_10562055

Overview

Basic Information

• Taxon OID: 3300013133
• Scaffold ID: Ga0172362_10562055
• Source Dataset Name: Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Restricted
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Scaffold Components

• Scaffold Length (bps): 777
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location

• Location Name: Rwanda: Western Province, Lake Kivu
• Coordinates
  • Lat. (^o): -2.05
  • Long. (^o): 29.2062
  • Depth (m): 388

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010603	Metagenome / Metatranscriptome	301	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0172362_105620552	F010603	AGG	MANEFQRSPIKAKGKAVRINSQGFDNVIEFTASSSGGTINTVATSDASLNVTLNGTSYRIPLFA*