Basic Information | |
---|---|
Taxon OID | 3300013103 Open in IMG/M |
Scaffold ID | Ga0164318_10317454 Open in IMG/M |
Source Dataset Name | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay9, Core 4571-4, 0-3 cm |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1378 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment → Subseafloor Sediment Microbial Communities From Guaymas Basin, Gulf Of California, Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mexico: Gulf of California | |||||||
Coordinates | Lat. (o) | 27.0183 | Long. (o) | -111.3802 | Alt. (m) | Depth (m) | 2000 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003253 | Metagenome / Metatranscriptome | 497 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0164318_103174542 | F003253 | N/A | MQSLTTLSQSAFDVKKAEAINNQLMRKEITLSEFNVIDNNHIDVDGVKIEVTDKAFGKLLGRLRIPKAFAKRFSEGFGNDGLRQLITMMKSAKSSKNEQTVTLLVDPNSRKITDILPAGYASISQESFIDFASRYIDQYNLGVTHMGSSQYGGTQINCVAPQGMFNVPGMTNEVFNTGVTFRNTPTRGLEVS |
⦗Top⦘ |