Basic Information | |
---|---|
Taxon OID | 3300013090 Open in IMG/M |
Scaffold ID | Ga0163209_1038560 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_160m |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1668 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Rwanda: Western Province | |||||||
Coordinates | Lat. (o) | -2.0288 | Long. (o) | 29.1756 | Alt. (m) | Depth (m) | 160 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F082076 | Metagenome | 113 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0163209_10385601 | F082076 | AGG | MNRRALVEYLLRKHQLVLAQLASSHDRFAALKNLERAEKRFLLAFVVALAGGTYWLAMELWGLNVSDLLTLPVHRVISLFFGLALLASSALAILGYLSIGLVIQRAVEIRPRDQVDEREL |
⦗Top⦘ |