Scaffold Ga0153913_1071035

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0153913_1071035

Scaffold Ga0153913_1071035

Overview

Basic Information
Taxon OID	3300013080 Open in IMG/M
Scaffold ID	Ga0153913_1071035 Open in IMG/M
Source Dataset Name	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaT (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	714
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands → Freshwater Wetland Microbial Communities From Ohio, Usa, Analyzing The Effect Of Biotic And Abiotic Controls

Source Dataset Sampling Location
Location Name	USA: Ohio, Lake Erie, Old Woman Creek
Coordinates	Lat. (^o)	41.3778	Long. (^o)	-82.5108	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007695	Metagenome / Metatranscriptome	346	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0153913_10710351	F007695	N/A	MKGNLRDKRRDPWHRANALLTAAADPALNGKTRTTIPSRVLTWFASRWRNHQSKRAEKPHSKSSDRKALDGPATRPETPLAVENSVGKLAAN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.