Scaffold Ga0170683_10067648

Overview

Basic Information

• Taxon OID: 3300013027
• Scaffold ID: Ga0170683_10067648
• Source Dataset Name: Gypsum rock hypoendolithic microbial communities from the Atacama Desert, Chile - Monturaqui
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Johns Hopkins Bayview Research CORES
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 950
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock → Gypsum Rock Endolithic And Hypoendolithic Microbial Communities

Source Dataset Sampling Location

• Location Name: Chile: Atacama Desert
• Coordinates
  • Lat. (^o): -23.57431
  • Long. (^o): -68.10215

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038578	Metagenome / Metatranscriptome	165	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0170683_100676482	F038578	AGG	VSYELVVLRGGIRDGETTTVAEGVRRLLAASDAPGLVDVYEANGETAPVEGNDEDGLVFLHVGQEPAGGLAPELQHAPRTTP*