Scaffold Ga0170683_10046948

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0170683_10046948

Scaffold Ga0170683_10046948

Overview

Basic Information
Taxon OID	3300013027 Open in IMG/M
Scaffold ID	Ga0170683_10046948 Open in IMG/M
Source Dataset Name	Gypsum rock hypoendolithic microbial communities from the Atacama Desert, Chile - Monturaqui
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Johns Hopkins Bayview Research CORES
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1177
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock → Gypsum Rock Endolithic And Hypoendolithic Microbial Communities

Source Dataset Sampling Location
Location Name	Chile: Atacama Desert
Coordinates	Lat. (^o)	-23.57431	Long. (^o)	-68.10215	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038578	Metagenome / Metatranscriptome	165	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0170683_100469482	F038578	N/A	MPDELVVLRGGVRDGESTTVQDGVRRLLAASDAPGLVEIYEANGETADVPGNPASALVFVHVGQESAGDLAPELQHSPRPAP*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.