Scaffold Ga0169965_1018031

Overview

Basic Information

• Taxon OID: 3300013012
• Scaffold ID: Ga0169965_1018031
• Source Dataset Name: Gypsum rock endolithic microbial communities from the Atacama Desert, Chile - Cordon de Lila
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Johns Hopkins Bayview Research CORES
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1699
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock → Gypsum Rock Endolithic And Hypoendolithic Microbial Communities

Source Dataset Sampling Location

• Location Name: Chile: Atacama Desert
• Coordinates
  • Lat. (^o): -23.53976
  • Long. (^o): -68.68737

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051097	Metagenome / Metatranscriptome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0169965_10180311	F051097	N/A	PAVWDSYQNVVQNLREKGLTEGITITSYYEDRQGETYQTTWTINPLLLEGSGYSDYKGYEDEVQALQDQARALEKISQDLDEVKEAINHRRDGQVN*