Scaffold Ga0164294_10003564

Overview

Basic Information

• Taxon OID: 3300013006
• Scaffold ID: Ga0164294_10003564
• Source Dataset Name: Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 13821
• Total Scaffold Genes: 22
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 13 (59.09%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 46.008
  • Long. (^o): -89.701
  • Depth (m): 4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038097	Metagenome	166	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0164294_1000356413	F038097	GGAG	MIYITNRDGTINLPWEPDLLEWLQTQYPYSKYRIVETS*