Scaffold Ga0157361_1053348

Overview

Basic Information

• Taxon OID: 3300012995
• Scaffold ID: Ga0157361_1053348
• Source Dataset Name: Fungus gardens microbial communities from leaf cutter ant in Ribeir?o Preto, State of S?o Paulo, Brazil - Atta laevigata ALBM2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 676
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae → Agaricus → Agaricus bisporus → Agaricus bisporus var. burnettii (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Fungus Garden → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities

Source Dataset Sampling Location

• Location Name: Brazil: Ribeir?o Preto, State of S?o Paulo
• Coordinates
  • Lat. (^o): -21.168
  • Long. (^o): -47.846

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025892	Metagenome	199	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0157361_10533482	F025892	AGGA	MIQVLTTWMLPQRLGRAERTASPDESQKVEPSIVPSILNPDWSNCPVERRRMVIPGTQYTGHSLEIAVLVVLFLGSMISCSIRTVPTA