Scaffold Ga0157150_1056440

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0157150_1056440

Scaffold Ga0157150_1056440

Overview

Basic Information
Taxon OID	3300012992 Open in IMG/M
Scaffold ID	Ga0157150_1056440 Open in IMG/M
Source Dataset Name	Pig viral communities from ears skin of healthy adult pig - Individual 0
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Autonomous University of Barcelona
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	719
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Skin → Unclassified → Unclassified → Pig Ears Skin → Pig Viral Communities From Oral Cavities And Ears Of Healthy Adults Pigs From Denmark

Source Dataset Sampling Location
Location Name	Denmark
Coordinates	Lat. (^o)	56.0	Long. (^o)	10.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053097	Metagenome / Metatranscriptome	141	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0157150_10564403	F053097	N/A	MFDIQGDKIRFNTEDLAIPPFKDHYNNAKDKGQALKEIEYVVWLHKWNTPYEAYPANQRAGIVAKDVFKTDKYIPSDEVKMLE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.