Basic Information | |
---|---|
Taxon OID | 3300012992 Open in IMG/M |
Scaffold ID | Ga0157150_1008215 Open in IMG/M |
Source Dataset Name | Pig viral communities from ears skin of healthy adult pig - Individual 0 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Autonomous University of Barcelona |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1502 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Skin → Unclassified → Unclassified → Pig Ears Skin → Pig Viral Communities From Oral Cavities And Ears Of Healthy Adults Pigs From Denmark |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Denmark | |||||||
Coordinates | Lat. (o) | 56.0 | Long. (o) | 10.0 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F082826 | Metagenome / Metatranscriptome | 113 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0157150_10082152 | F082826 | N/A | MRYKIQCNYNAFITVDVEANDEGEALDKARNYAEDADIRQFNIGEEKESRILETE* |
⦗Top⦘ |