Scaffold Ga0159060_1120588

Overview

Basic Information

• Taxon OID: 3300012990
• Scaffold ID: Ga0159060_1120588
• Source Dataset Name: Tailings pond microbial communities from Northern Alberta -TP6_2010 BML May 2015
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: McGill University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 724
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Wastewater Microbial Communities From Base Mine Lake, Ft. Mcmurray, Alberta, Canada - Surface, May 2015

Source Dataset Sampling Location

• Location Name: Canada: Alberta
• Coordinates
  • Lat. (^o): 57.02
  • Long. (^o): -111.55

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012081	Metagenome / Metatranscriptome	284	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0159060_11205882	F012081	GAGG	MKSMRVQFWAGWGLVSRLMFAVGLAIVVGGGVQTSLLLAEGAAEHSARLQREVSETLTFLAPLVADQAILSEYAAIDQLLRNQVKKGEIDRLVWTDKSGKKTVAQD