Scaffold Ga0164308_10298549

Overview

Basic Information

• Taxon OID: 3300012985
• Scaffold ID: Ga0164308_10298549
• Source Dataset Name: Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1278
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Amended Soil Microbial Communities From New York, Usa To Study Carbon Cycling

Source Dataset Sampling Location

• Location Name: USA: Mt. Pleasant research farm, Cornell University, New York
• Coordinates
  • Lat. (^o): 42.4531
  • Long. (^o): -76.3842
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027461	Metagenome / Metatranscriptome	194	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0164308_102985493	F027461	AGGA	MWLYFIPLYIAGAIIFMFALFALLGRFRGGRYVRPIMQGLAKVPGVRGLMMKASRAALAKQNPEAASALQKLERAGVANDPQRAQAALSRLSASERRAYLEAAGQEGALPEPQNRQQRRAMEKLQR