Scaffold Ga0129332_1073225

Overview

Basic Information

• Taxon OID: 3300012969
• Scaffold ID: Ga0129332_1073225
• Source Dataset Name: Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 701
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → unclassified Legionellales → Legionellales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location

• Location Name: USA: Chesapeake Bay
• Coordinates
  • Lat. (^o): 37.1043
  • Long. (^o): -76.1811

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053968	Metagenome / Metatranscriptome	140	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0129332_10732252	F053968	AGGAG	MARITTSATVEAGSGLGKTHYVYAIATGTITTAAAAQAIAASPYFGTIASVEGTGDGEHVMVQGGAGGAEA