Scaffold Ga0164302_11630710

Overview

Basic Information

• Taxon OID: 3300012961
• Scaffold ID: Ga0164302_11630710
• Source Dataset Name: Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 538
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Amended Soil Microbial Communities From New York, Usa To Study Carbon Cycling

Source Dataset Sampling Location

• Location Name: USA: Mt. Pleasant research farm, Cornell University, New York
• Coordinates
  • Lat. (^o): 42.4531
  • Long. (^o): -76.3842
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055969	Metagenome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0164302_116307101	F055969	GGA	MAKRWTDAELRFLRDNATKMSVQALADSLGVRVDELEKRMEKLGPTGPVAVDAPKKAQTLKELSRSTENARKEYDKGVAALQRRKIEEAERHFLDLIVKYPDEKEVVDRARVYL