Scaffold Ga0154020_10147811

Overview

Basic Information

• Taxon OID: 3300012956
• Scaffold ID: Ga0154020_10147811
• Source Dataset Name: Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2231
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge → Active Sludge And Wastewater Microbial Communities From Klosterneuburg, Austria

Source Dataset Sampling Location

• Location Name: Austria: Klosterneuburg
• Coordinates
  • Lat. (^o): 48.3
  • Long. (^o): 16.2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102362	Metagenome	101	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0154020_101478114	F102362	AGCAGG	MRVGRQTKSHARNPELPIKQQSMNTTTPLTSRSLNDANVAATQRAVSQTLGGLLSPLDSRLAKAFQAHRDHPLLRPFCNIFERHLKIELDQQSFIWSDTLRLNTRVVQAIDAAPISEDEKNRAAFWLVLFHTSYFALGYQTRYLKAAPDQQTMLNLAFTQAVAHHMRSLGVKQPANSPHWEQHGYVFKPLAALPAGPKIAEEALTLLEQGALQSADLTGTPLLELTDLNGRVANLQDFSP