Scaffold Ga0164298_10238468

Overview

Basic Information

• Taxon OID: 3300012955
• Scaffold ID: Ga0164298_10238468
• Source Dataset Name: Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1089
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Amended Soil Microbial Communities From New York, Usa To Study Carbon Cycling

Source Dataset Sampling Location

• Location Name: USA: Mt. Pleasant research farm, Cornell University, New York
• Coordinates
  • Lat. (^o): 42.4531
  • Long. (^o): -76.3842
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094119	Metagenome / Metatranscriptome	106	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0164298_102384682	F094119	AGG	MTMGARYGGLKVFSCALFVSALMFAAEALAAPRAAELGPEMPFAEPAGGFVGKLSVTPHRGPAGTRVTVSGEAFAPEQEFDLVWRTVKGRWKVTLAEYHGREFAPAGYRIATARSDKAGRIAASFIVPEDFGFLHDIVVQQGRRLLTQTAFNVEMMVKLGQNKGPLGSPIAIEVQGIGWRCSRAAGYCSTTTSSPASCRRSQPAAPPASI*