Scaffold Ga0163179_10217198

Overview

Basic Information

• Taxon OID: 3300012953
• Scaffold ID: Ga0163179_10217198
• Source Dataset Name: Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1472
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location

• Location Name: North Atlantic Ocean
• Coordinates
  • Lat. (^o): 34.876
  • Long. (^o): -13.1352
  • Depth (m): 80

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068135	Metagenome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0163179_102171982	F068135	N/A	MKYKVGDIVLVKSSAGPAIPHFKVQLLKYIKRQTSFDPPYIIWKARLTKRKEVDMLRKQWQIPFKFPDEVETFVYETNVIKLIKSNG*