Scaffold Ga0163180_10044044

Overview

Basic Information

• Taxon OID: 3300012952
• Scaffold ID: Ga0163180_10044044
• Source Dataset Name: Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2659
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location

• Location Name: North Atlantic Ocean
• Coordinates
  • Lat. (^o): 26.049
  • Long. (^o): -17.4585
  • Depth (m): 80

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092701	Metagenome / Metatranscriptome	107	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0163180_100440443	F092701	GAG	MGVLLEQAHELETDQLEETRERVRSALYEKLLSLDPKQVREMLAYHLRRCTTPSCPTCNRVRERAAQRKQQRQKSEKRMRLWRGVAKSIGPMLALRARAAQTTYAPGGQGYHAARHSFESAQSHQSEGDK*