NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126375_10788934

Scaffold Ga0126375_10788934


Overview

Basic Information
Taxon OID3300012948 Open in IMG/M
Scaffold IDGa0126375_10788934 Open in IMG/M
Source Dataset NameTropical forest soil microbial communities from Panama - MetaG Plot_14
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)751
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions

Source Dataset Sampling Location
Location NamePanama
CoordinatesLat. (o)9.1086Long. (o)-79.8436Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007994Metagenome / Metatranscriptome341Y
F014921Metagenome / Metatranscriptome259Y

Sequences

Protein IDFamilyRBSSequence
Ga0126375_107889341F007994AGTAGGMGESQKAGAAASRGGESGPDRTEMILTPDQRLRVFISSTLGELAAER
Ga0126375_107889343F014921N/AAEVRSRAASLPGPGQIRALEAAALTRPRASLTPAEIRTLAEEAIAHLHEVAGKLAELSALLGHDEAEEGKP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.